Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triose phosphate/phosphate translocator, chloroplastic (TPT)

This Recombinant Triose phosphate/phosphate translocator, chloroplastic (TPT) spans the amino acid sequence from region 83-408.

Product Specifications

Product Name Alternative

Triose phosphate/phosphate translocator, chloroplastic, cTPT

UniProt

P49131

Expression Region

83-408

Origin

Flaveria pringlei

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATASDSAGDAAPVGFFAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSAIHL AVGVVYCLGGWAVGLPKRAPMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKS LEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTY RSIYSKKAMTDMDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDAIAKVGMTKFIS DLFWVGMFYHLYNQLAINTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNKISTQTAIGTS IAIAGVAVYSLIKAKIEEEKRGLKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DUSP10 Recombinant Protein
PROTQ9Y6W6-01 10 µg

Human DUSP10 Recombinant Protein

Sign In for Pricing
View Details
Human DUSP10 Recombinant Protein
PROTQ9Y6W6-02 50 µg

Human DUSP10 Recombinant Protein

Sign In for Pricing
View Details
Human DUSP10 Recombinant Protein
PROTQ9Y6W6-03 100 µg

Human DUSP10 Recombinant Protein

Sign In for Pricing
View Details
Human DUSP10 Recombinant Protein
PROTQ9Y6W6-04 250 µg

Human DUSP10 Recombinant Protein

Sign In for Pricing
View Details
DPP10 (NM_020868) Human Tagged ORF Clone Lentiviral Particle
RC205435L1V 200 µL

DPP10 (NM_020868) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MURF2 Peptide
45-919P 0.1 mg

MURF2 Peptide

Sign In for Pricing
View Details