Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Palmitoyltransferase ERF2 (ERF2)

This Recombinant Candida glabrata Palmitoyltransferase ERF2 (ERF2) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Palmitoyltransferase ERF2, EC= 2.3.1.-, DHHC cysteine-rich domain-containing protein ERF2, Ras protein acyltransferase

UniProt

Q6FSS4

Expression Region

1-326

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGNPSTHEVIGTMSTRRFYRWLITIDGDTEINYRNYEELPSRSNYIFFFGGRLRAVKTA RPFSLVVLFLILSPMVLFSVFEAHRLWHTRYGYKALVVLFYYAWAWSLLSFTKTATSDPG VLPRNIHMHKDTPQEYFNNVTLPYGAGGSAGNASVTLKYCHTCKIWRPPRASHCSVCECC VLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLIANCALHLHRALHEGIRVSHRPL PVAVLLCVYAAVLCVYPVILLGYHVAMSGTQQTTREYLRSIGFRNPVMHRIRRRRDNPYA EHGFLRNMLDLMAEPRGPRSCNYRYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL
BNC400413-500 1x 500 µL

Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details