Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Brucella suis biovar 1 Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q8G022

Expression Region

1-327

Origin

Brucella suis biovar 1 (strain 1330)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKLIVLSLALLLDRFIGDPPLLWQRISHPVVLLGKAISWGEKNFNDSSLPPSTLRRNG MWLTVGLVAACIFAGLVIRSILPHAGTAGAIVEVVIVAILLAQKSLADHVQAVAQALRDD GIEGGRKAVSMIVGRNPDRLDEGGVSRAAIESLAENASDGIVAPAFWFLVGGLPGLFAYK LINTADSMIGHLNDRYRDFGRFAAKLDDVANYIPARLTGLLAALATSLGHGREAGRQALS IMCRDARLHRSPNAGWPEAAFAGALGLALAGPRQYGAETVEGPMLNATGKREAEARDIDA ALVLFWSTMSLMTGLVIAASLVGLFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-500 1x 500 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details