Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Brucella melitensis biotype 1 Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q8YHT9

Expression Region

1-327

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKLIVLSLALLLDRFIGDLPLLWQRISHPVVLLGKAISWGEKNFNDSSLPPSTLRRNG MWLTVGLVAACIFAGLVIRSILPHAGTAGAIAEVVIVAILLAQKSLADHVQAVAQALRDD GIEGGRKAVSMIVGRNPDRLDEGGVSRAAIESLAENASDGIVAPAFWFLVGGLPGLFAYK FINTADSMIGHLNDRYRDFGRFAAKLDDVANYIPARLTGLLAALATSLGHGREAGRQALS IMCRDARLHRSPNAGWPEAAFAGALGLALAGPRQYGAETVEGPMLNATGKREAEARDIDA ALVLFWSTMSLMTGLVIAASLVGLFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NM23A (NME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI21H5]
TA801521AM 100 µL

NM23A (NME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI21H5]

Sign In for Pricing
View Details
DDX4 (NM_024415) Human Recombinant Protein
TP310628L 1 mg

DDX4 (NM_024415) Human Recombinant Protein

Sign In for Pricing
View Details
2-Furoic Acid
TRC-F863775-5G 5 g

2-Furoic Acid

Sign In for Pricing
View Details
AAAS Antibody
OC-2072-01 50 μL

AAAS Antibody

Sign In for Pricing
View Details
AAAS Antibody
OC-2072-02 100 µL

AAAS Antibody

Sign In for Pricing
View Details
AAAS Antibody
OC-2072-03 1 mL

AAAS Antibody

Sign In for Pricing
View Details