Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Brucella melitensis biotype 1 Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q8YHT9

Expression Region

1-327

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKLIVLSLALLLDRFIGDLPLLWQRISHPVVLLGKAISWGEKNFNDSSLPPSTLRRNG MWLTVGLVAACIFAGLVIRSILPHAGTAGAIAEVVIVAILLAQKSLADHVQAVAQALRDD GIEGGRKAVSMIVGRNPDRLDEGGVSRAAIESLAENASDGIVAPAFWFLVGGLPGLFAYK FINTADSMIGHLNDRYRDFGRFAAKLDDVANYIPARLTGLLAALATSLGHGREAGRQALS IMCRDARLHRSPNAGWPEAAFAGALGLALAGPRQYGAETVEGPMLNATGKREAEARDIDA ALVLFWSTMSLMTGLVIAASLVGLFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc finger protein 668 (ZNF668) Human Gene Knockout Kit (CRISPR)
KN400813 1 Kit

Zinc finger protein 668 (ZNF668) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS802163 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Ubiquitin Rabbit Polyclonal Antibody
ER31212 100 µL

Ubiquitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CXCL12
6508 5 µg

Recombinant Mouse CXCL12

Sign In for Pricing
View Details
Recombinant Human AIFM1 Protein (His Tag)
PKSH032089-01 10 µg

Recombinant Human AIFM1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human AIFM1 Protein (His Tag)
PKSH032089-02 50 µg

Recombinant Human AIFM1 Protein (His Tag)

Sign In for Pricing
View Details