Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Brucella melitensis biotype 1 Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q8YHT9

Expression Region

1-327

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKLIVLSLALLLDRFIGDLPLLWQRISHPVVLLGKAISWGEKNFNDSSLPPSTLRRNG MWLTVGLVAACIFAGLVIRSILPHAGTAGAIAEVVIVAILLAQKSLADHVQAVAQALRDD GIEGGRKAVSMIVGRNPDRLDEGGVSRAAIESLAENASDGIVAPAFWFLVGGLPGLFAYK FINTADSMIGHLNDRYRDFGRFAAKLDDVANYIPARLTGLLAALATSLGHGREAGRQALS IMCRDARLHRSPNAGWPEAAFAGALGLALAGPRQYGAETVEGPMLNATGKREAEARDIDA ALVLFWSTMSLMTGLVIAASLVGLFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIP5 Human Gene Knockout Kit (CRISPR)
KN418727 1 Kit

BNIP5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VCAM1 Recombinant Rabbit monoclonal Antibody
HA750009 100 µL

VCAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Trim28 Mouse Gene Knockout Kit (CRISPR)
KN518196 1 Kit

Trim28 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APEH Polyclonal Antibody
E-AB-12756-01 20 µL

APEH Polyclonal Antibody

Sign In for Pricing
View Details
APEH Polyclonal Antibody
E-AB-12756-02 60 µL

APEH Polyclonal Antibody

Sign In for Pricing
View Details
APEH Polyclonal Antibody
E-AB-12756-03 120 µL

APEH Polyclonal Antibody

Sign In for Pricing
View Details