Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Duck hepatitis B virus Large envelope protein (S)

This Recombinant Duck hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-328.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P0C684

Expression Region

2-328

Origin

Duck hepatitis B virus (strain Germany/DHBV-3) (DHBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQHPAKSMDVRRIEGGELLLNQLAGRMIPKGTLTWSGKFPTIDHVLDHVQTMEEINTLQQ QGAWPAGAGRRVGLSNPAPQEIPQPQWTPEEDQKAREAFRRYQEERPPETTTIPPTSPTQ WKLQPGDDPLLGNQSLLETHPLYQTEPAVPVIKTPPLKKKMSGTFGGILAGLIGLLVSFF LLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPHYAGSCPWGCPGFLWTYLRLF IIFLLILLVAAGLLYLTDNGSTILGKLQWASVSALFSSISSLLPSDPKSLVALTFGLSLI WMTSSSATQTLVTLTQLATLSALFYKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF405S conjugate, 0.1mg/mL
BNC042750-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
γ-Tocopherol
TRC-T526140-50MG 50 mg

γ-Tocopherol

Sign In for Pricing
View Details
Human IL-29 (Interleukin 29) ELISA Kit
E-EL-H5509-01 24 Tests

Human IL-29 (Interleukin 29) ELISA Kit

Sign In for Pricing
View Details
Human IL-29 (Interleukin 29) ELISA Kit
E-EL-H5509-02 48 Tests

Human IL-29 (Interleukin 29) ELISA Kit

Sign In for Pricing
View Details
Human IL-29 (Interleukin 29) ELISA Kit
E-EL-H5509-03 96 Tests

Human IL-29 (Interleukin 29) ELISA Kit

Sign In for Pricing
View Details
Rhod-2, tripotassium salt
21067-AAT 1 mg

Rhod-2, tripotassium salt

Sign In for Pricing
View Details