Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 175 (RNF175)

This Recombinant Human RING finger protein 175 (RNF175) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

RING finger protein 175

UniProt

Q8N4F7

Expression Region

1-328

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGTAARKAAPVLEAPPQQEQLSHTKLSAEDTWNLQQERMYKMHRGHDSMHVEMILIFL CVLVIAQIVLVQWRQRHGRSYNLVTLLQMWVVPLYFTIKLYWWRFLSMWGMFSVITSYIL FRATRKPLSGRTPRLVYKWFLLIYKLSYAFGVVGYLAIMFTMCGFNLFFKIKARDSMDFG IVSLFYGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKIIVELDE EGLIENTYQLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMISNPWERTHFLYGQI LDWLRYLVAWQPVVIGIVQGIIYSLGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
RD-TGFb1-c-01 96 Tests

Canine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
Canine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
RD-TGFb1-c-02 48 Tests

Canine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
Human COQ3 activation kit by CRISPRa
GA109992 1 Kit

Human COQ3 activation kit by CRISPRa

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF594 conjugate, 0.1mg/mL
BNC940410-100 1x 100 µL

MALT-1 (MT1/410), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPS31 Rabbit Polyclonal Antibody
TA378681 100 µL

MRPS31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2643), CF568 conjugate, 0.1mg/mL
BNC682643-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2643), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details