Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0421 protein SSP0904 (SSP0904)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0421 protein SSP0904 (SSP0904) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

UPF0421 protein SSP0904

UniProt

Q49YT4

Expression Region

1-328

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDNWYKKIIGARTIKTGLATFLTALFCLALNLNPIFAILTAIVTIEPTAKASLKKGYRR LPATIIGALFAVIFTFIFGDQSPFAYALSATFTIILCTKLNLHVGTTVATLTAMAMIPGI HEAYFFNFFSRLLTAIIGLVTAGLVNFIILPPKYYDQVESSINLTESKMYELFELRMRQL LLGKFTKGAPYRQLNQLIDLNQKVETLLSYQKDELSYHKHHDSEWIQLKALTTRAHTNRL FITHLSNLVYLPKDTIITFTNDEKLAILSIAQSINNIYSTGHFERKKQHASLLKMSVKGL DEFDSNQLKSHVIYEILLIYRILDHRFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reelin Rabbit monoclonal antibody
orb2297793-01 25 µL

Reelin Rabbit monoclonal antibody

Sign In for Pricing
View Details
Reelin Rabbit monoclonal antibody
orb2297793-02 50 µL

Reelin Rabbit monoclonal antibody

Sign In for Pricing
View Details
Reelin Rabbit monoclonal antibody
orb2297793-03 100 µL

Reelin Rabbit monoclonal antibody

Sign In for Pricing
View Details
omniPAGE Mini - IEF Conversion kit for 2 x 7cm IPG strips
VS10-IEFKIT 1 Unit

omniPAGE Mini - IEF Conversion kit for 2 x 7cm IPG strips

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) MDTB Polyclonal Antibody
MBS7169620 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) MDTB Polyclonal Antibody

Sign In for Pricing
View Details
Rat Granulin (GRN) Protein
abx653625-01 10 µg

Rat Granulin (GRN) Protein

Sign In for Pricing
View Details