Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis UPF0421 protein SERP1427 (SERP1427)

This Recombinant Staphylococcus epidermidis UPF0421 protein SERP1427 (SERP1427) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

UPF0421 protein SERP1427

UniProt

Q5HN45

Expression Region

1-328

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDKWYRHIIGARTIKTGLATFFTSLFCMLLNLTPIFAILTAIVTIEPTAKASLKKGYKR LPATVIGALFAVVFTYVFGDQSPLSYALSATFTILICTKLNLQVGTTVAVLTSVAMIPGI HEAYVFNFFSRLLTALIGLVTAGLVNFIILPPKYYHQLEEQLALSEKKMYRLFYERCNEL LLGKFSSEKTSKELSKLNIIAQKVETLMSYQRDELHYHKNEDNWKLLNRLTNRAYNNRLF ISHLSNIIYLPKHTSIAFDANEKIALINISNSINGIIQKGSFARQKKSIATLKSSVKQMD EFDQNQMKSTLIYEILLIYKILDSRYAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP25 antibody - middle region (ARP58423_P050)
ARP58423_P050 100 µL

ARHGAP25 antibody - middle region (ARP58423_P050)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)
MBS2059987-01 0.1 mL

APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)
MBS2059987-02 0.2 mL

APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)
MBS2059987-03 0.5 mL

APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)
MBS2059987-04 1 mL

APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)
MBS2059987-05 5 mL

APC-Linked Polyclonal Antibody to Neuregulin 1 (NRG1)

Sign In for Pricing
View Details