Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0421 protein SA1705 (SA1705)

This Recombinant Staphylococcus aureus UPF0421 protein SA1705 (SA1705) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

UPF0421 protein SA1705

UniProt

Q7A4R6

Expression Region

1-328

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGTFKREDDSVETLRSTIKAL EISGENQIKSHILYEVLMIYRLLDSRYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF740 conjugate, 0.1mg/mL
BNC742095-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MLV p30 Gag protein Rabbit Polyclonal Antibody
AP33447PU-N 100 µg

MLV p30 Gag protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF640R conjugate, 0.1mg/mL
BNC403136-500 1x 500 µL

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF740 conjugate, 0.1mg/mL
BNC740200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35), CF740 conjugate, 0.1mg/mL
BNC740445-100 1x 100 µL

Muscle Specific Actin (HHF35), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS801730 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details