Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0421 protein SAR1980 (SAR1980)

This Recombinant Staphylococcus aureus UPF0421 protein SAR1980 (SAR1980) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

UPF0421 protein SAR1980

UniProt

Q6GFG8

Expression Region

1-328

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEI ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGSFKREDDSVETLRSTIKAL EISGENQIKSHILYEVLMIYRLLDSRYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin inhibitor DE-3 Antibody
orb28460-01 50 µg

Trypsin inhibitor DE-3 Antibody

Sign In for Pricing
View Details
Trypsin inhibitor DE-3 Antibody
orb28460-02 100 µg

Trypsin inhibitor DE-3 Antibody

Sign In for Pricing
View Details
Histone H2B Type 2-E (HIST2H2BE) Antibody
abx001597-01 20 µL

Histone H2B Type 2-E (HIST2H2BE) Antibody

Sign In for Pricing
View Details
Histone H2B Type 2-E (HIST2H2BE) Antibody
abx001597-02 100 µL

Histone H2B Type 2-E (HIST2H2BE) Antibody

Sign In for Pricing
View Details
Histone H2B Type 2-E (HIST2H2BE) Antibody
abx001597-03 2x 100 µL

Histone H2B Type 2-E (HIST2H2BE) Antibody

Sign In for Pricing
View Details
C9orf86 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2375313 100 µL

C9orf86 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details