Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Two pore potassium channel protein sup-9 (sup-9)

This Recombinant Two pore potassium channel protein sup-9 (sup-9) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Two pore potassium channel protein sup-9, Suppressor of unc-93 protein 9, n2P38

UniProt

O17185

Expression Region

1-329

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRQNIRTLSLIVCTLTYLLVGAAVFDALETENEILQRKLVQRVREKLKTKYNMSNADYE ILEATIVKSVPHKAGYQWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCMLYALAGIPL GLIMFQSIGERMNTFAAKLLRFIRRAAGKQPIVTSSDLIIFCTGWGGLLIFGGAFMFSSY ENWTYFDAVYYCFVTLTTIGFGDYVALQKRGSLQTQPEYVFFSLVFILFGLTVISAAMNL LVLRFLTMNTEDERRDEQEAILAAQGLVRVGDPTADDDFGRLPLSDNVSLASCSCYQLPD EKLRHRHRKHTEPHGGPPTFSGMTTRPKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details