Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sideroflexin-5 (sfxn-5)

This Recombinant Sideroflexin-5 (sfxn-5) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Sideroflexin-5

UniProt

Q5FC79

Expression Region

1-331

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALDETLFGYPIYPKFKLGEPRFPQDTFLGRYLHCLDVIDPRTLFASNKKLEESLELLNS FKAGTATNVPDKSLWEAQKLKSAILHPDTGEKVLPPFRMSGFVPFGWITVTGMLLPNPSW PTLLFWQWMNQSHNACVNYANRNATQPQPLSKYIGAYGAAVTAACSISGGLTYFIKKASS LPPTTRIIIQRFVPLPATSLASSLNVICMRWNELETGIQVYEKDTGKVVGVSKVAAKQAV TDTTMVRAFLPVPLLLMPPCIMPYLERFKWVTKTQVRHIFVNAIVCTLSFAVSLPVALAL FPQESAISREQLEPELQQKTKNSLLYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEFM Human Gene Knockout Kit (CRISPR)
KN423435 1 Kit

TEFM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
9,10-Dihydro-gamma-oxo-2-phenanthrenebutanoic Acid
TRC-D454745-250MG 250 mg

9,10-Dihydro-gamma-oxo-2-phenanthrenebutanoic Acid

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL
BNC942344-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYD88 (NM_002468) Human Over-expression Lysate
LC432175 20 µg

MYD88 (NM_002468) Human Over-expression Lysate

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF740 conjugate, 0.1mg/mL
BNC742745-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XIAP Human Gene Knockout Kit (CRISPR)
KN207627LP 1 Kit

XIAP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details