Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-10 (Tspan10)

This Recombinant Mouse Tetraspanin-10 (Tspan10) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Tetraspanin-10, Tspan-10, Oculospanin

UniProt

Q8VCF5

Expression Region

1-331

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEEECSPLLSQDTAGREHPLTRNSPPTANIPCPAPWENQKGSWGCRCCPGAKRQASGEG QASSLPLSTGSNCVKYLIFLSNFLFSLPSLLALAAGLWGLTVKRSQGIGWGGPVPTDPML MLVLGGLVVSVVSLSGCLGAFCENSCLLHWYCGAVLFCLALEALAGVLMVTLWKPLQDSL KYTLHAAIIHYWDDPDLHFLLDQVQLGLQCCGAVSYQDWQQNLYFNCSSPGVQACSLPAS CCINPQEDGAVVNTQCGFGALGLDQNVAGQVVFLQGCWPALQEWLRGNTGAIGDCAVAVV MIQGTELLLAACLLRALAVHEAAEDIEAGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cyclin B1 CCNB1 Antibody (Human)
B2022784 100 µL

Rabbit Polyclonal Cyclin B1 CCNB1 Antibody (Human)

Sign In for Pricing
View Details
COX7CP1 Protein Vector (Human) (pPB-C-His)
PV070657 500 ng

COX7CP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
APC Anti-Mouse TCR beta (H57-597)
MBS4165294-01 0.1 mg

APC Anti-Mouse TCR beta (H57-597)

Sign In for Pricing
View Details
APC Anti-Mouse TCR beta (H57-597)
MBS4165294-02 5x 0.1 mg

APC Anti-Mouse TCR beta (H57-597)

Sign In for Pricing
View Details
SFTPA1 Recombinant Protein (Human)
RP096681 100 µg

SFTPA1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Monkey Coatomer subunit zeta 1 (COPZ1) ELISA kit
GTR10448114 96 Well

Monkey Coatomer subunit zeta 1 (COPZ1) ELISA kit

Sign In for Pricing
View Details