Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-10 (Tspan10)

This Recombinant Mouse Tetraspanin-10 (Tspan10) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Tetraspanin-10, Tspan-10, Oculospanin

UniProt

Q8VCF5

Expression Region

1-331

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEEECSPLLSQDTAGREHPLTRNSPPTANIPCPAPWENQKGSWGCRCCPGAKRQASGEG QASSLPLSTGSNCVKYLIFLSNFLFSLPSLLALAAGLWGLTVKRSQGIGWGGPVPTDPML MLVLGGLVVSVVSLSGCLGAFCENSCLLHWYCGAVLFCLALEALAGVLMVTLWKPLQDSL KYTLHAAIIHYWDDPDLHFLLDQVQLGLQCCGAVSYQDWQQNLYFNCSSPGVQACSLPAS CCINPQEDGAVVNTQCGFGALGLDQNVAGQVVFLQGCWPALQEWLRGNTGAIGDCAVAVV MIQGTELLLAACLLRALAVHEAAEDIEAGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC691272 3'UTR Luciferase Stable Cell Line
TU212311 1.0 mL

LOC691272 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat rno-miR-200b-3p miRNA Agomir
abx884635-01 5 nmol

Rat rno-miR-200b-3p miRNA Agomir

Sign In for Pricing
View Details
Rat rno-miR-200b-3p miRNA Agomir
abx884635-02 10 nmol

Rat rno-miR-200b-3p miRNA Agomir

Sign In for Pricing
View Details
BAT3, CT (BAG6, BAT3, G3, Large proline-rich protein BAG6, BAG family molecular chaperone regulator 6, BCL2-associated athanogene 6, HLA-B-associated transcript 3, Protein G3, Protein Scythe) (MaxLight 405) discontinued
032431-ML405 100 µL

BAT3, CT (BAG6, BAT3, G3, Large proline-rich protein BAG6, BAG family molecular chaperone regulator 6, BCL2-associated athanogene 6, HLA-B-associated transcript 3, Protein G3, Protein Scythe) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ARL4P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV757477 1.0 µg DNA

ARL4P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Chst8 Pre-designed siRNA Set B
SI102587B 1 Each

Mouse Chst8 Pre-designed siRNA Set B

Sign In for Pricing
View Details