Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-10 (Tspan10)

This Recombinant Mouse Tetraspanin-10 (Tspan10) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Tetraspanin-10, Tspan-10, Oculospanin

UniProt

Q8VCF5

Expression Region

1-331

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEEECSPLLSQDTAGREHPLTRNSPPTANIPCPAPWENQKGSWGCRCCPGAKRQASGEG QASSLPLSTGSNCVKYLIFLSNFLFSLPSLLALAAGLWGLTVKRSQGIGWGGPVPTDPML MLVLGGLVVSVVSLSGCLGAFCENSCLLHWYCGAVLFCLALEALAGVLMVTLWKPLQDSL KYTLHAAIIHYWDDPDLHFLLDQVQLGLQCCGAVSYQDWQQNLYFNCSSPGVQACSLPAS CCINPQEDGAVVNTQCGFGALGLDQNVAGQVVFLQGCWPALQEWLRGNTGAIGDCAVAVV MIQGTELLLAACLLRALAVHEAAEDIEAGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNE4 siRNA Oligos set (Human)
25353171 3x 5 nmol

KCNE4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Nkx2-2 Mouse siRNA Oligo Duplex (Locus ID 18088)
SR407005 1 Kit

Nkx2-2 Mouse siRNA Oligo Duplex (Locus ID 18088)

Sign In for Pricing
View Details
Rat ELA4 (Elastase 4) ELISA Kit
MBS2511645-01 24 Tests (Limit 1)

Rat ELA4 (Elastase 4) ELISA Kit

Sign In for Pricing
View Details
Rat ELA4 (Elastase 4) ELISA Kit
MBS2511645-02 48 Tests

Rat ELA4 (Elastase 4) ELISA Kit

Sign In for Pricing
View Details
Rat ELA4 (Elastase 4) ELISA Kit
MBS2511645-03 96 Tests

Rat ELA4 (Elastase 4) ELISA Kit

Sign In for Pricing
View Details
Rat ELA4 (Elastase 4) ELISA Kit
MBS2511645-04 5x 96 Tests

Rat ELA4 (Elastase 4) ELISA Kit

Sign In for Pricing
View Details