Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK686.3 (ZK686.3)

This Recombinant Uncharacterized protein ZK686.3 (ZK686.3) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK686.3

UniProt

P34669

Expression Region

1-331

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLAVYESAQQQTLEDKVQNLVDLTSRQSIVKFNMDKWKTLVRMQPRNYSMIVMFTALSP GVQCPICKPAYDEFMIVANSHRYTSSEGDRRKVFFGIVDYEDAPQIFQQMNLNTAPILYH FGPKLGAKKRPEQMDFQRQGFDADAIGRFVADQTEVHVRVIRPPNYTAPVVIALFVALLL GMLYMKRNSLDFLFNRTVWGFVCLAITFIFMSGQMWNHIRGPPFMITNPNTKEPSFIHGS TQFQLIAETYIVGLLYALIAIGFICVNEAADQSNSKDRKNAGKKLNPLSLLNIPTNTLAI AGLVCICVFFSFLLSVFRSKYRGYPYSFLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF1 (NM_001111284) Human Over-expression Lysate
LC426359 20 µg

IGF1 (NM_001111284) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MROH5 activation kit by CRISPRa
GA118069 1 Kit

Human MROH5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR559408 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
(R)-1-((R)-6-Fluorochroman-2-yl)-2-(((S)-2-((S)-6-fluorochroman-2-yl)-2-hydroxyethyl)amino)ethan-1-ol
TRC-F422960-10MG 10 mg

(R)-1-((R)-6-Fluorochroman-2-yl)-2-(((S)-2-((S)-6-fluorochroman-2-yl)-2-hydroxyethyl)amino)ethan-1-ol

Sign In for Pricing
View Details
APC Anti-Human CD19 Antibody[SJ25C1]
AN00334E-01 20 Tests

APC Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
APC Anti-Human CD19 Antibody[SJ25C1]
AN00334E-02 100 Tests

APC Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details