Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Palmitoyltransferase PFA3 (PFA3)

This Recombinant Candida glabrata Palmitoyltransferase PFA3 (PFA3) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Palmitoyltransferase PFA3, EC= 2.3.1.-, Protein fatty acyltransferase 3

UniProt

Q6FW70

Expression Region

1-332

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLVNNFSKLFPRCLTTGLYLWSLYAIVVCIHVIRARVVLPLVFTIAMVALYTYAKLIYV GPGTTKEYSILRVYDLNAAESGFELPPEMLVKRSYTQKRNGRFRVCKSCSSWKPDRCHHC STCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVLILSSMEIYTWFKGEFF EVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQTTIELYSLRRYNEEVAFLNEFS NEPIKGTINIFDLGKKLINWEEVMGYSLIEWALPISRRPSSLDLEGSHSHGLFFNVNKNV SKTMNESVDLQDRLLRRLTPRSSLDVDRSNFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-100 1x 100 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-100 1x 100 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details