Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction alpha-4 protein (Gja4)

This Recombinant Mouse Gap junction alpha-4 protein (Gja4) spans the amino acid sequence from region 2-333.

Product Specifications

Product Name Alternative

Gap junction alpha-4 protein, Connexin-37, Cx37

UniProt

P28235

Expression Region

2-333

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDL HVERALAAIEHQMAKISVAEDGRLRIRGALMGTYVVSVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPHIVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREIK ARRDHDARPAQGSASDPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERLT SSRPPPFVNTAPQGGRKSPSRPNSSASKKQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ERP44 Antibody [Allophycocyanin]
NBP2-97000APC 0.1 mL

Rabbit Polyclonal ERP44 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
UBTD1 antibody
70R-9764 50 ug

UBTD1 antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)
MBS1178927-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)
MBS1178927-02 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)
MBS1178927-03 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)
MBS1178927-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details