Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction alpha-4 protein (Gja4)

This Recombinant Mouse Gap junction alpha-4 protein (Gja4) spans the amino acid sequence from region 2-333.

Product Specifications

Product Name Alternative

Gap junction alpha-4 protein, Connexin-37, Cx37

UniProt

P28235

Expression Region

2-333

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDL HVERALAAIEHQMAKISVAEDGRLRIRGALMGTYVVSVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPHIVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREIK ARRDHDARPAQGSASDPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERLT SSRPPPFVNTAPQGGRKSPSRPNSSASKKQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SnoN (SKIL) Rabbit Polyclonal Antibody
TA312882 100 µL

SnoN (SKIL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Arylsulfatase B Antibody
MBS8217086-01 0.03 mL

Anti-Arylsulfatase B Antibody

Sign In for Pricing
View Details
Anti-Arylsulfatase B Antibody
MBS8217086-02 0.05 mL

Anti-Arylsulfatase B Antibody

Sign In for Pricing
View Details
Anti-Arylsulfatase B Antibody
MBS8217086-03 0.1 mL

Anti-Arylsulfatase B Antibody

Sign In for Pricing
View Details
Anti-Arylsulfatase B Antibody
MBS8217086-04 0.2 mL

Anti-Arylsulfatase B Antibody

Sign In for Pricing
View Details
Anti-Arylsulfatase B Antibody
MBS8217086-05 5x 0.2 mL

Anti-Arylsulfatase B Antibody

Sign In for Pricing
View Details