Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia amylovora Glucitol/sorbitol-specific phosphotransferase enzyme IIB component (srlE)

This Recombinant Erwinia amylovora Glucitol/sorbitol-specific phosphotransferase enzyme IIB component (srlE) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Glucitol/sorbitol-specific phosphotransferase enzyme IIB component, EC= 2.7.1.69, EII-Gut, PTS system glucitol/sorbitol-specific EIIB component

UniProt

O32522

Expression Region

1-333

Origin

Erwinia amylovora (Fire blight bacteria)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANTIEIRKGESGWGGPLSINVTAGKKIVYITAGTKPAIVDHLVALTGWEAVDGFKQGEP PAEEIGVAVIDCGGTLRCGLYPKRRIPTINIHATGKSGPLAQFITEDIYVSGVRVADIRV ANDAEAAPPEVAVADVAVNAGKGTGRDYDTSKKITEQSDGLLAKVGMGMGSAVAILFQSG RETIDTVLKTILPFMAFVSALIGIIMASGLGDFIAHGLTPLANSPVGLVTLALICSFPLL SPFLGPGAVIAQVIGVLVGVQIGQGTIPPHLALPALFAINAQAACDFIPVGLSLANARQE TVRVGVPAVLVGRFITGAPTVLLAWAASSFIYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dad1 (NM_001113358) Mouse Tagged ORF Clone
MG215800 10 µg

Dad1 (NM_001113358) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal BTBD12 Antibody [DyLight 680]
NBP1-28680FR 100 µL

Rabbit Polyclonal BTBD12 Antibody [DyLight 680]

Sign In for Pricing
View Details
HRP-3 Polyclonal Conjugated Antibody
orb1618260 100 µL

HRP-3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Suppressor of Ty 4 homolog 1 Antibody (OTI6B10) [Alexa Fluor 700]
NBP2-74412AF700 0.1 mL

Mouse Monoclonal Suppressor of Ty 4 homolog 1 Antibody (OTI6B10) [Alexa Fluor 700]

Sign In for Pricing
View Details
NGAL CRISPR Activation Plasmid (m)
sc-421398-ACT 20 µg

NGAL CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Human TMEM131L Pre-designed siRNA Set A
SI016807A 1 Each

Human TMEM131L Pre-designed siRNA Set A

Sign In for Pricing
View Details