Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Acyl-CoA desaturase (SCD)

This Recombinant Pig Acyl-CoA desaturase (SCD) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Acyl-CoA desaturase, EC= 1.14.19.1, Delta (9) -desaturase, Delta-9 desaturase, Fatty acid desaturase, Stearoyl-CoA desaturase

UniProt

O02858

Expression Region

1-334

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSYTTTTTITAPSSRVLQNGGGKSEKTPQYVEEDIRPEMKDDIYDPTYQDKEGPQGKLEY VWRNIILMSLLHLGALYGIILIPTCKIYTLLWAFAYYLLSAVGVTAGAHRLWSHRTYKAR LPLRVFLIIANTMAFQNDVYEWARDHRAHHKFSETDADPHNSRRGFFFSHVGWLLVRKHP AVKEKGGLLNMSDLKAEKLVMFQRRYYKPGILLMCFILPTIVPWYCWGEAFPQSLFVATF LRYAIVLNATWLVNSAAHLYGYRPYDKTISPRENILVSLGAVGEGFHNYHHTFPYDYSAS EYRWHINLTTFFIDCMAALGLAYDRKKVSKAAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-500 1x 500 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL
BNC882316-100 1x 100 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740731-100 1x 100 µL

AMACR / p504S (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details