Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-25 (sra-25)

This Recombinant Serpentine receptor class alpha-25 (sra-25) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-25, Protein sra-25

UniProt

O17847

Expression Region

1-335

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNELIDGPKCASEGIVNAMTSIPVKISFLIIATVIFLSFYFARLAILALLRNNIFSNSTQ RILLVCLVNSVFHQAATLEIRIHQVYRSFVYASDPCSLLFHFTECEVELYFYYLTNYFST YSVFSLTFDRLISHYNPRFYFSQQNFVSNTLLIIQCLLSFGTYYVGLYGVPPFGYVSICY YTPKYAVNFLKINDFRTVVMVFCIIVIIFVYYLSVRSEKQIQRTSYSPGERYWAYENVET SQSVCILIVLQFACILMSSYGVNYIRSKESMMSEEDFHTLAPFFAGVTYASLCLPLVIYF KTKLTIRNRRIRIAVMTSMYGDVGDHMNRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Monocyte Chemotactic Protein 3 ELISA Kit
MBS020038-01 48 Well

Hamster Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Monocyte Chemotactic Protein 3 ELISA Kit
MBS020038-02 96 Well

Hamster Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Monocyte Chemotactic Protein 3 ELISA Kit
MBS020038-03 5x 96 Well

Hamster Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Monocyte Chemotactic Protein 3 ELISA Kit
MBS020038-04 10x 96 Well

Hamster Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)
MBS7035162-01 0.02 mg

Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)
MBS7035162-02 0.1 mg

Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)

Sign In for Pricing
View Details