Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-25 (sra-25)

This Recombinant Serpentine receptor class alpha-25 (sra-25) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-25, Protein sra-25

UniProt

O17847

Expression Region

1-335

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNELIDGPKCASEGIVNAMTSIPVKISFLIIATVIFLSFYFARLAILALLRNNIFSNSTQ RILLVCLVNSVFHQAATLEIRIHQVYRSFVYASDPCSLLFHFTECEVELYFYYLTNYFST YSVFSLTFDRLISHYNPRFYFSQQNFVSNTLLIIQCLLSFGTYYVGLYGVPPFGYVSICY YTPKYAVNFLKINDFRTVVMVFCIIVIIFVYYLSVRSEKQIQRTSYSPGERYWAYENVET SQSVCILIVLQFACILMSSYGVNYIRSKESMMSEEDFHTLAPFFAGVTYASLCLPLVIYF KTKLTIRNRRIRIAVMTSMYGDVGDHMNRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-BTK (pY551) Antibody
YLD0990-01 50 µL

Rabbit anti-BTK (pY551) Antibody

Sign In for Pricing
View Details
Rabbit anti-BTK (pY551) Antibody
YLD0990-02 100 µL

Rabbit anti-BTK (pY551) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal SNAPC4 Antibody (PCRP-SNAPC4-3A7) [Janelia Fluor 525]
NBP3-24111JF525 0.1 mL

Mouse Monoclonal SNAPC4 Antibody (PCRP-SNAPC4-3A7) [Janelia Fluor 525]

Sign In for Pricing
View Details
Catecholamine (CA) Porcine ELISA Kit
C1794 96 Tests

Catecholamine (CA) Porcine ELISA Kit

Sign In for Pricing
View Details
ELISA Kit for C Reactive Protein (CRP)
TRV-0037194-01 24 Tests

ELISA Kit for C Reactive Protein (CRP)

Sign In for Pricing
View Details
ELISA Kit for C Reactive Protein (CRP)
TRV-0037194-02 48 Tests

ELISA Kit for C Reactive Protein (CRP)

Sign In for Pricing
View Details