Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_234099 (PHYPADRAFT_234099)

This Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_234099 (PHYPADRAFT_234099) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

CASP-like protein PHYPADRAFT_234099

UniProt

A9SU70

Expression Region

1-336

Origin

Physcomitrella patens subsp. patens (Moss)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKGPGLDPSWSLAGTPCFKSTRLGKTHLESTAGGAQTGARLDPVQIARHSMCSSSVRLD HGPLPVGVAAMQGETFGPGADSQRSASGAEYQQLTCARLSVRDICYKLHAAARISMESGA WDSEYFDKRATPGVGAVGGSKMPPPHAHGAVAPPPAMYNNPAMESNKDDNFFGAIVLSLR AAQIVFTVVGLGVMGSLKHTSHGDYYYYYYDFSFTQVDSYIGVLSLDVIVCLYAIVQLVL CFIQRSNQGKYLSSPTTVAAKLTFVFDQVLAYALVATAGAAAGSALEIRKGTSCSGTWTV ICSKGEASVAMSFFAFAFLAATAAVYSVRLLRITGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF740 conjugate, 0.1mg/mL
BNC741830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (6E1.), CF647 conjugate, 0.1mg/mL
BNC470051-100 1x 100 µL

Thyroglobulin (6E1.), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details