Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium beijerinckii Glucitol/sorbitol-specific phosphotransferase enzyme IIB component (srlE)

This Recombinant Clostridium beijerinckii Glucitol/sorbitol-specific phosphotransferase enzyme IIB component (srlE) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Glucitol/sorbitol-specific phosphotransferase enzyme IIB component, EC= 2.7.1.69, EII-Gut, PTS system glucitol/sorbitol-specific EIIB component

UniProt

O32333

Expression Region

1-336

Origin

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKYNAIKIVKGSGGFGGPLTVKPEEGKDTLLYITGGGAEPEIVEKIVNLTGCKAVNGFK TSVPEEQIFLVIIDCGGTLRCGIYPQKRIPTINVMPVGKSGPLAKFITEDIYVSAVGLNQ ISLADSSAEPIKSTKVPEEGKREFKYSADKKVSQSLAENSKSSIVQKIGMGAGKVVNTLY QAGRDAVQSMITTILPFMAFVAMLIGIIQGSGFGNWFAKILVPLAGNGIGLMILGFICSI PLLSALLGPGAVIAQIVGTLIGVEIGKGTIPPSLALPALFAINTQCACDFIPVGLGLAEA EPETVEVGVPSVLYSRFMIGVPRVAVAWVASIGLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS629429 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
FITC Anti-Mouse CD18 Antibody[M18/2]
E-AB-F1113UC-01 25 µg

FITC Anti-Mouse CD18 Antibody[M18/2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD18 Antibody[M18/2]
E-AB-F1113UC-02 100 µg

FITC Anti-Mouse CD18 Antibody[M18/2]

Sign In for Pricing
View Details
Acid Orange 5 Potassium Salt
TRC-O670640-5G 5 g

Acid Orange 5 Potassium Salt

Sign In for Pricing
View Details
MET Mouse Monoclonal Antibody [Clone ID: OTI3G5]
CF805796 100 µg

MET Mouse Monoclonal Antibody [Clone ID: OTI3G5]

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559109 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details