Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0284909 (DDB_G0284909)

This Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0284909 (DDB_G0284909) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Uncharacterized transmembrane protein DDB_G0284909

UniProt

Q54NZ2

Expression Region

1-337

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLKINIRPNEIIFLICIVVIFSFSYTLTYFDSPIFKEHYITNNGNDFGVENHFVTYHST YKEDIHKRIIDPHHGLIQEITKTFYPVSSPLEKLFSFSDNILIVLIIVQVIVGFLIFLLS VEKLSKCNYQLKSIFSTKSTFYINNNNNNNNEDINNNNNNNNNNNNKNKNDERNNEEIED EETIRKEKILIIKKKRDILLAIIIFFLVLLGVLTIIYVSFIPLNIRKAFIGQQFYYKGSI DPLCADISNEGDHHIGKCKSLNGRIGNVNDKIFGYSWSLDSGLFNVKIVFFSTILIEFLT GCLILLMKFKKDPNIVPLTKPSIASPTQIPHLFCIAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (HM47/A9), CF405S conjugate, 0.1mg/mL
BNC040477-500 1x 500 µL

CD79a (HM47/A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details