Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sideroflexin-4 (SFXN4)

This Recombinant Human Sideroflexin-4 (SFXN4) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Sideroflexin-4, Breast cancer resistance marker 1

UniProt

Q6P4A7

Expression Region

1-337

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELLDPTNVFISVE SIENSRQLLCTNEDVSSPASADQRIQEAWKRSLATVHPDSSNLIPKLFRPAAFLPFMAPT VFLSMTPLKGIKSVILPQVFLCAYMAAFNSINGNRSYTCKPLERSLLMAGAVASSTFLGV IPQFVQMKYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRI AGTKAVRETLASRIVLFGTSALIPEVFTYFFKRTQYFRKNPGSLWILKLSCTVLAMGLMV PFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIP-1a (Macrophage Inflammatory Protein 1 Alpha) BioAssayTM ELISA Kit (Rat) discontinued
357323-01 48 Tests

MIP-1a (Macrophage Inflammatory Protein 1 Alpha) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
MIP-1a (Macrophage Inflammatory Protein 1 Alpha) BioAssayTM ELISA Kit (Rat) discontinued
357323-02 96 Tests

MIP-1a (Macrophage Inflammatory Protein 1 Alpha) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
HtrA2 Antibody
orb1731828 100 µL

HtrA2 Antibody

Sign In for Pricing
View Details
TOMM22 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2491941 100 µL

TOMM22 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
NMDAR2A Rabbit Polyclonal Antibody
orb1741889 100 µL

NMDAR2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Dihydrolipoyl Dehydrogenase (DLD)
TRV-0035082-01 20 µL

Monoclonal Antibody to Dihydrolipoyl Dehydrogenase (DLD)

Sign In for Pricing
View Details