Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sideroflexin-4 (SFXN4)

This Recombinant Human Sideroflexin-4 (SFXN4) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Sideroflexin-4, Breast cancer resistance marker 1

UniProt

Q6P4A7

Expression Region

1-337

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELLDPTNVFISVE SIENSRQLLCTNEDVSSPASADQRIQEAWKRSLATVHPDSSNLIPKLFRPAAFLPFMAPT VFLSMTPLKGIKSVILPQVFLCAYMAAFNSINGNRSYTCKPLERSLLMAGAVASSTFLGV IPQFVQMKYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRI AGTKAVRETLASRIVLFGTSALIPEVFTYFFKRTQYFRKNPGSLWILKLSCTVLAMGLMV PFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 3 alpha (MIP-3-alpha, MIP3A, MIP-3a, Beta Chemokine Exodus-1, CC Chemokine LARC, C-C Motif Chemokine 20, Chemokine (C-C Motif) Ligand 20, CCL20, CKb4, Liver and Activation-regulated Chemokine) (APC)
M1202-60P 100 Tests

Macrophage Inflammatory Protein 3 alpha (MIP-3-alpha, MIP3A, MIP-3a, Beta Chemokine Exodus-1, CC Chemokine LARC, C-C Motif Chemokine 20, Chemokine (C-C Motif) Ligand 20, CCL20, CKb4, Liver and Activation-regulated Chemokine) (APC)

Sign In for Pricing
View Details
BTN1A1 Rabbit Polyclonal Antibody
orb2952157-01 50 µg

BTN1A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BTN1A1 Rabbit Polyclonal Antibody
orb2952157-02 100 µg

BTN1A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRITC mixed isomers
CTRITC-10mg 10 mg

TRITC mixed isomers

Sign In for Pricing
View Details
Mouse Biotin, clone Hyb-8 (Monoclonal) Antibody
orb372023 100 µg

Mouse Biotin, clone Hyb-8 (Monoclonal) Antibody

Sign In for Pricing
View Details
Lentiviral human PDE1A sgRNA gene knockout kit - Lentiviral human PDE1A sgRNA gene knockout kit (25)
GTR15386643 1 Vial

Lentiviral human PDE1A sgRNA gene knockout kit - Lentiviral human PDE1A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details