Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T28D9.3 (T28D9.3)

This Recombinant Uncharacterized protein T28D9.3 (T28D9.3) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Uncharacterized protein T28D9.3

UniProt

Q10022

Expression Region

1-341

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRDHVEFCYYVIIYSLEKFQQRSKQFGISLFIFFLATAAVTVIVPTLLGVSQRGFFCDDD SIRYEYRKDTITAVQLMLYNLVLNAATVLFVEYYRMQKVESNINNPRYRWRNNHLHVLFV RLLTYFGYSQIGFVMNIALNIVTKHVVGRLRPHFLDVCKLANDTCVTGDSHRYITDYTCT GPPELVLEARKSFYSGHSAVSLYCATWSALYIQARLGPVLNNRIVVPISQTLMFMIGLGI SFSRITDNKHHWSDVLVGIFIGIFLAVYTCTFWTDLFSNNSTESETQPLLLPRPPRTPRN SEDEERHRLDAVLPSTDSSIVFEATGPQDSDTILLPVPQSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA3 (Ab-308) Antibody
E11-0933B 100 µg

GATA3 (Ab-308) Antibody

Sign In for Pricing
View Details
CCL1 ELISA Kit (Human)
OKDD01874-48W 48 Tests

CCL1 ELISA Kit (Human)

Sign In for Pricing
View Details
Goat anti-Mouse IgG2a Cross-Adsorbed Antibody Affinity Purified
A90-207A 0.5 mg

Goat anti-Mouse IgG2a Cross-Adsorbed Antibody Affinity Purified

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Ras-related protein Rab-11A (rab11A)
MBS1072632-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Ras-related protein Rab-11A (rab11A)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Ras-related protein Rab-11A (rab11A)
MBS1072632-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Ras-related protein Rab-11A (rab11A)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Ras-related protein Rab-11A (rab11A)
MBS1072632-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Ras-related protein Rab-11A (rab11A)

Sign In for Pricing
View Details