Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein YIPF3 (yipf3)

This Recombinant Xenopus laevis Protein YIPF3 (yipf3) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Protein YIPF3, YIP1 family member 3

UniProt

Q3B8G4

Expression Region

1-341

Origin

Xenopus laevis (African clawed frog)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSSGSSRNLTAADWGGFDDNMQSGGGAAVIDMENMDDTSGSSFEDMGEIHQHMKEEEE EVEGEGVPEDGEEDGAFLGMKGVQGQLGRQVADEMWQAGKRQASKAFNLYANIDILRPYF DVEPIQVRHRLLESMIPVKMISFPQKIAGELYGPLMLVFTMVAILLHGMKSSGTIIREGT LMGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQTLSLLGYGLFGHCIVLFITYNIHFH SLFYIFWLCIGGLSTLRMVAVLLSRTVGHTQRLIVCGTMAALHMLFLLYLHFAYHKVVEG ILDTLDGQNVPLPIQRVARDLPVGPNTVLNATVQVLLAHSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDHD1 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-8316R-PE-Cy5.5 100 µL

HDHD1 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
ATAD4 Antibody (C-term)
E45R03796G-1 100 µL

ATAD4 Antibody (C-term)

Sign In for Pricing
View Details
C-Peptide (Proinsulin) (HRP) discontinued
171477-HRP 100 µL

C-Peptide (Proinsulin) (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Il20rb shRNA (UAS) - Lentiviral mouse Il20rb shRNA (UAS, RFP) plasmid
GTR15280165 1 Vial

Lentiviral mouse Il20rb shRNA (UAS) - Lentiviral mouse Il20rb shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Monoclonal IL-1 RI Antibody (129304) [Biotin]
FAB7712B 0.5 mL

Rat Monoclonal IL-1 RI Antibody (129304) [Biotin]

Sign In for Pricing
View Details
HDAC2 Rabbit mAb
MBS8602848-01 0.1 mL

HDAC2 Rabbit mAb

Sign In for Pricing
View Details