Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium vitis Protease HtpX homolog (htpX)

This Recombinant Agrobacterium vitis Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B9JUJ0

Expression Region

1-342

Origin

Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4) )

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIMRTAMLLAFMTALFMGVGFLIGGKGGMMIALVIAGAMNLFSYWNSDRMVLSAYHAQE VDPRNAPEFYEIVRGLTQNAGLPMPKVYIFDNPQPNAFATGRNPQNAAVAASTGLLQALT PEEVAGVMAHELAHVEHRDTLTMTITATLAGAISMLGNFAFFFGGRRDENGNGGGIIGPL VAMIVAPFAAMLVQMAISRTREYAADRRGAEICGNPLWLASALAKIAGAHQPNYQAERNP ATAHMFIINPLSGQKMDSLFSTHPDTSNRIAALQALAQEMGGRQANVYRPQHSKPAASGP WGSSAERSTDDPWGVKGGASTRSVPKIGRRGKDNDAPKGPWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF740 conjugate, 0.1mg/mL
BNC740429-500 1x 500 µL

CD19 (CVID3/429), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF640R conjugate, 0.1mg/mL
BNC402062-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details