Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ciona intestinalis Voltage-gated hydrogen channel 1 (HVCN1)

This Recombinant Ciona intestinalis Voltage-gated hydrogen channel 1 (HVCN1) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Voltage-gated hydrogen channel 1, Hydrogen voltage-gated channel 1, HV1, Voltage sensor domain-only protein

UniProt

Q1JV40

Expression Region

1-342

Origin

Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDNCNKSRHKSHNMINPNYASVRCTQPLPSVIQLRSRNKMIGITEDPSSDSEPVSSNQ PLLLTNLSYEVHTFNDNNNHERPAPQEQSTQNTMISMQSEQKSDRFTASNLGMFQYMKFE IGEDGDDHEEEAILTNREKLRHILHSKPIHVAIIVLVVLDSFLVVGELLIDLKVIIVPHG NPAPEILHGFSLSILSIFMVEIALKIIADHRHFIHHKVEVLDAVVVVISFGVDIALIFVG ESEALAAIGLLVILRLWRVFRIINGIIVTVKTKADDRVHEIKKKNSELELQIHNLEEKLS QKEQDMSRLHEILRCNNIDIPPTVPLTTSVQIHSTTTASADV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF488A conjugate, 0.1mg/mL
BNC880828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF740 conjugate, 0.1mg/mL
BNC742302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details