Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea abies Photosystem Q (B) protein

This Recombinant Picea abies Photosystem Q (B) protein spans the amino acid sequence from region 2-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P50155

Expression Region

2-344

Origin

Picea abies (Norway spruce) (Picea excelsa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAIIERRESANLWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANAGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVAGIWFTALGISTMALNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF738 activation kit by CRISPRa
GA115658 1 Kit

Human ZNF738 activation kit by CRISPRa

Sign In for Pricing
View Details
CellBrite® Steady 405 Membrane Staining Kit, 500 Labelings
#30105 1 Kit

CellBrite® Steady 405 Membrane Staining Kit, 500 Labelings

Sign In for Pricing
View Details
Aldolase A/B/C Recombinant Chimeric Antibody Antibody
HA601511 100 µL

Aldolase A/B/C Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Fmoc-Arg (Pbf) TentaGel® R HMPA Resin
RA1502.5G 5 g

Fmoc-Arg (Pbf) TentaGel® R HMPA Resin

Sign In for Pricing
View Details
COX4 (COX4I1) Rabbit Polyclonal Antibody
TA367419 100 µL

COX4 (COX4I1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR141 (NM_181791) Human Over-expression Lysate
LC403629 20 µg

GPR141 (NM_181791) Human Over-expression Lysate

Sign In for Pricing
View Details