Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A2C6Q1

Expression Region

1-343

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIRSGRLSSWESFCNWVTSTNNRIYVGWFGVLMVPTLLAAAICFTIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAASVDEWLYNGGPYQLVVFHFLI GICCWLGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPVGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMIGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVICIWITSLGISTMAFNLNGFN FNQSVLDAQGRVVPTWADVLNRSNLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR561864 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
ENPP3 Mouse Monoclonal Antibody [Clone ID: NP4D6]
AM12003PE-N 100 Tests

ENPP3 Mouse Monoclonal Antibody [Clone ID: NP4D6]

Sign In for Pricing
View Details
eIF3s8 (EIF3C) (NM_003752) Human Over-expression Lysate
LY401236 100 µg

eIF3s8 (EIF3C) (NM_003752) Human Over-expression Lysate

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), 1mg/mL
BNUM1481-50 1x 50 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), 1mg/mL

Sign In for Pricing
View Details
Human Beta Nerve Growth Factor Recombinant Rabbit Monoclonal Antibody [PSH07-81] - BSA and Azide free (Detector)
HA722904 100 µL

Human Beta Nerve Growth Factor Recombinant Rabbit Monoclonal Antibody [PSH07-81] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Tauro 6-Ethylchenodeoxycholic Acid Sodium SaltREPLACES E917458.
TRC-T009025-25MG 25 mg

Tauro 6-Ethylchenodeoxycholic Acid Sodium SaltREPLACES E917458.

Sign In for Pricing
View Details