Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A2C6Q1

Expression Region

1-343

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIRSGRLSSWESFCNWVTSTNNRIYVGWFGVLMVPTLLAAAICFTIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAASVDEWLYNGGPYQLVVFHFLI GICCWLGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPVGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMIGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVICIWITSLGISTMAFNLNGFN FNQSVLDAQGRVVPTWADVLNRSNLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(4-Boc-piperazino)pyrimidine-5-boronic acid pinacol ester
TRC-B663205-250MG 250 mg

2-(4-Boc-piperazino)pyrimidine-5-boronic acid pinacol ester

Sign In for Pricing
View Details
ZNF317 Mouse Monoclonal Antibody [Clone ID: OTI3A8]
CF812517 100 µg

ZNF317 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

Sign In for Pricing
View Details
Calpastatin (CAST) Human Gene Knockout Kit (CRISPR)
KN402168 1 Kit

Calpastatin (CAST) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COX7A2 (NM_001865) Human Over-expression Lysate
LY419693 100 µg

COX7A2 (NM_001865) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PRR11 activation kit by CRISPRa
GA110956 1 Kit

Human PRR11 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560092 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details