Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

A5GTY5

Expression Region

1-343

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAVRSGRVSSWESFCQWVTNTDNRIYVGWFGVLMIPCLLAATICYIIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVIPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVVFHFLI GISAYMGRQWELSYRLGMRPWICVAYAAPLSAAMVVFLIYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTSMGIATMAFNLNGFN FNQSILDAQGKVVPTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl bromoacetate
sc-239316 50 g

Benzyl bromoacetate

Sign In for Pricing
View Details
Recombinant Human KIT/c-KIT/CD117 Protein
MBS9139711-01 0.01 mg

Recombinant Human KIT/c-KIT/CD117 Protein

Sign In for Pricing
View Details
Recombinant Human KIT/c-KIT/CD117 Protein
MBS9139711-02 0.02 mg

Recombinant Human KIT/c-KIT/CD117 Protein

Sign In for Pricing
View Details
Recombinant Human KIT/c-KIT/CD117 Protein
MBS9139711-03 0.05 mg

Recombinant Human KIT/c-KIT/CD117 Protein

Sign In for Pricing
View Details
Recombinant Human KIT/c-KIT/CD117 Protein
MBS9139711-04 0.1 mg

Recombinant Human KIT/c-KIT/CD117 Protein

Sign In for Pricing
View Details
Recombinant Human KIT/c-KIT/CD117 Protein
MBS9139711-05 5x 0.1 mg

Recombinant Human KIT/c-KIT/CD117 Protein

Sign In for Pricing
View Details