Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

A5GTY5

Expression Region

1-343

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAVRSGRVSSWESFCQWVTNTDNRIYVGWFGVLMIPCLLAATICYIIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVIPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVVFHFLI GISAYMGRQWELSYRLGMRPWICVAYAAPLSAAMVVFLIYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTSMGIATMAFNLNGFN FNQSILDAQGKVVPTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srsf5 AAV siRNA Pooled Vector
45520166 1.0 µg

Srsf5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TSG-6 (E-1) HRP
sc-377277 HRP 200 µg/mL

TSG-6 (E-1) HRP

Sign In for Pricing
View Details
AKAP13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
11647061 1.0 µg DNA

AKAP13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal HDGF Antibody (PCRP-HDGF-1D1) [PerCP]
NBP3-26942PCP 0.1 mL

Mouse Monoclonal HDGF Antibody (PCRP-HDGF-1D1) [PerCP]

Sign In for Pricing
View Details
FAM18B2 (TVP23C) Human shRNA Plasmid Kit (Locus ID 201158)
TR304674 1 Kit

FAM18B2 (TVP23C) Human shRNA Plasmid Kit (Locus ID 201158)

Sign In for Pricing
View Details
Rad51, phosphorylated (T309) discontinued
341503-01 100 µL

Rad51, phosphorylated (T309) discontinued

Sign In for Pricing
View Details