Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 120A (Tmem120a)

This Recombinant Rat Transmembrane protein 120A (Tmem120a) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Transmembrane protein 120A, Transmembrane protein induced by tumor necrosis factor alpha

UniProt

Q5HZE2

Expression Region

1-343

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRVKLEELTKLQDNCTNSITRQKKRLQE LALVLKKCRPSLPSESLEAAQELESQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP ECKEWQVLMCGLPFLLLFLGNFFTTLRVVHQKFHSQQHGSKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6 Antibody
KC-367-01 50 μL

IL6 Antibody

Sign In for Pricing
View Details
IL6 Antibody
KC-367-02 100 µL

IL6 Antibody

Sign In for Pricing
View Details
IL6 Antibody
KC-367-03 1 mL

IL6 Antibody

Sign In for Pricing
View Details
Mouse mLlt11 activation kit by CRISPRa
GA206088 1 Kit

Mouse mLlt11 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Sulfotransferase 2A1 Antibody
RC-15864-01 50 μL

Recombinant Sulfotransferase 2A1 Antibody

Sign In for Pricing
View Details
Recombinant Sulfotransferase 2A1 Antibody
RC-15864-02 100 µL

Recombinant Sulfotransferase 2A1 Antibody

Sign In for Pricing
View Details