Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 3, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 3, Photosystem II protein D1 3

UniProt

Q0I910

Expression Region

1-343

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAVRSGRLSSWQSFCQWVTDTNNRIYIGWFGVLMIPCLLAATTCFIVAFIAAPPVDID GIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWDAASLDEWLYNGGTYQLVVFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESHNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFLLGAWPVVGIWFTSMGVSTMAFNLNGFN FNQSILDSQGRVLNTWADMVNRAGLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WFDC9 Human Gene Knockout Kit (CRISPR)
KN422677 1 Kit

WFDC9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human ENHO Protein (Trx Tag)
PDEH100587-01 20 µg

Recombinant Human ENHO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human ENHO Protein (Trx Tag)
PDEH100587-02 100 µg

Recombinant Human ENHO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human ENHO Protein (Trx Tag)
PDEH100587-03 500 µg

Recombinant Human ENHO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human ENHO Protein (Trx Tag)
PDEH100587-04 1 mg

Recombinant Human ENHO Protein (Trx Tag)

Sign In for Pricing
View Details
Caspr2 (CNTNAP2) Rabbit Monoclonal Antibody
TA424001 100 µL

Caspr2 (CNTNAP2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details