Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 3, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 3, Photosystem II protein D1 3

UniProt

Q0I910

Expression Region

1-343

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAVRSGRLSSWQSFCQWVTDTNNRIYIGWFGVLMIPCLLAATTCFIVAFIAAPPVDID GIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWDAASLDEWLYNGGTYQLVVFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESHNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFLLGAWPVVGIWFTSMGVSTMAFNLNGFN FNQSILDSQGRVLNTWADMVNRAGLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iron(II) Phthalocyanine
TRC-I775260-250MG 250 mg

Iron(II) Phthalocyanine

Sign In for Pricing
View Details
WHAMM (NM_001080435) Human Over-expression Lysate
LC421652 20 µg

WHAMM (NM_001080435) Human Over-expression Lysate

Sign In for Pricing
View Details
BCL2A1 Recombinant Rabbit monoclonal Antibody
HA750205 100 µL

BCL2A1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS648742 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Human NUDT14 activation kit by CRISPRa
GA116853 1 Kit

Human NUDT14 activation kit by CRISPRa

Sign In for Pricing
View Details
Paraffin Oils
TRC-P193283-500ML 500 mL

Paraffin Oils

Sign In for Pricing
View Details