Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA3)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q3AKT2

Expression Region

1-343

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAIRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAAPPVDID GIREPVAGSLIYGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVCFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEAESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGFN FNQSILDSQGRVLNTWADVLNRANLGMEVQHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human XPO5 Protein, N-His
orb2967314-01 50 µg

Recombinant Human XPO5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human XPO5 Protein, N-His
orb2967314-02 100 µg

Recombinant Human XPO5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human XPO5 Protein, N-His
orb2967314-03 1 mg

Recombinant Human XPO5 Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal SRM Antibody
NBP3-30219 100 µg

Rabbit Polyclonal SRM Antibody

Sign In for Pricing
View Details
Human PARD6B qPCR Primer Pair
QH56113S 200 Tests

Human PARD6B qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human MYL3 shRNA (UAS) - Lentiviral human MYL3 shRNA (UAS) (100)
GTR15323349 1 Vial

Lentiviral human MYL3 shRNA (UAS) - Lentiviral human MYL3 shRNA (UAS) (100)

Sign In for Pricing
View Details