Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA3)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA3) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q3AKT2

Expression Region

1-343

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAIRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAAPPVDID GIREPVAGSLIYGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVCFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEAESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGFN FNQSILDSQGRVLNTWADVLNRANLGMEVQHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GC (Glucosylceramidase, GLUC, Acid beta-Glucosidase, GBA, Alglucerase, beta-Glucocerebrosidase, D-glucosyl-N-acylsphingosine Glucohydrolase, Imiglucerase) (Azide free) (HRP)
G2022-98-HRP 200 µL

GC (Glucosylceramidase, GLUC, Acid beta-Glucosidase, GBA, Alglucerase, beta-Glucocerebrosidase, D-glucosyl-N-acylsphingosine Glucohydrolase, Imiglucerase) (Azide free) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal GIPR Antibody (591827) [PE/Atto594]
MAB82102PEATT594 0.1 mL

Mouse Monoclonal GIPR Antibody (591827) [PE/Atto594]

Sign In for Pricing
View Details
ORC3L CRISPR All-in-one AAV vector set (with saCas9)(Human)
35730151 3x 1.0 µg DNA

ORC3L CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Mouse ALCAM/CD166 Protein (Fc Tag)
PKSM040954-01 10 µg

Recombinant Mouse ALCAM/CD166 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ALCAM/CD166 Protein (Fc Tag)
PKSM040954-02 50 µg

Recombinant Mouse ALCAM/CD166 Protein (Fc Tag)

Sign In for Pricing
View Details
Cartpt siRNA Oligos set (Rat)
15049176 3x 5 nmol

Cartpt siRNA Oligos set (Rat)

Sign In for Pricing
View Details