Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q7U669

Expression Region

1-343

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAIRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAAPPVDID GIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVCFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGVSTMAFNLNGFN FNQSILDGQGRVVNTWADMVNRAGLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 650)
MBS6228419-01 0.1 mL

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 650)

Sign In for Pricing
View Details
KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 650)
MBS6228419-02 5x 0.1 mL

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (MaxLight 650)

Sign In for Pricing
View Details
Olfr1444 Blocking peptide (C terminal region)
AAP96573-100UG 100 µg

Olfr1444 Blocking peptide (C terminal region)

Sign In for Pricing
View Details
Hsa-miR-6791-3p inhibitor
HY-RI02146-01 5 nmol

Hsa-miR-6791-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-6791-3p inhibitor
HY-RI02146-02 20 nmol

Hsa-miR-6791-3p inhibitor

Sign In for Pricing
View Details
RPL7P42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV775811 1.0 µg DNA

RPL7P42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details