Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q7U669

Expression Region

1-343

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAIRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAAPPVDID GIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVCFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGVSTMAFNLNGFN FNQSILDGQGRVVNTWADMVNRAGLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vascular Endothelial Cell Growth Factor A (VEGF-A) Microsample Fast ELISA Kit
orb1806672-01 48 Tests

Mouse Vascular Endothelial Cell Growth Factor A (VEGF-A) Microsample Fast ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Endothelial Cell Growth Factor A (VEGF-A) Microsample Fast ELISA Kit
orb1806672-02 96 Tests

Mouse Vascular Endothelial Cell Growth Factor A (VEGF-A) Microsample Fast ELISA Kit

Sign In for Pricing
View Details
BHMT Mouse mAb
63148 100 µL

BHMT Mouse mAb

Sign In for Pricing
View Details
LRRC63 (m) -PR
sc-149101-PR 10 µM - 20 µL

LRRC63 (m) -PR

Sign In for Pricing
View Details
NANOG, NT (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (PE) discontinued
038784-PE 200 µL

NANOG, NT (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Eaf6 Antibody
NBP2-84013-0.1mL 0.1 mL

Rabbit Polyclonal Eaf6 Antibody

Sign In for Pricing
View Details