Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA)

This Recombinant Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 2-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9BBU3

Expression Region

2-344

Origin

Lotus japonicus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAILERRESENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spike S1 RBD, Fc-Fusion, Avi-Tag, Biotin-labeled (SARS-CoV-2) Recombinant
100695-3 200 µg

Spike S1 RBD, Fc-Fusion, Avi-Tag, Biotin-labeled (SARS-CoV-2) Recombinant

Sign In for Pricing
View Details
APC-Linked Anti-Interleukin 2 Receptor Alpha (IL2Ra) Polyclonal Antibody
TRV-0020746-01 50 Tests

APC-Linked Anti-Interleukin 2 Receptor Alpha (IL2Ra) Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Anti-Interleukin 2 Receptor Alpha (IL2Ra) Polyclonal Antibody
TRV-0020746-02 100 Tests

APC-Linked Anti-Interleukin 2 Receptor Alpha (IL2Ra) Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Anti-Interleukin 2 Receptor Alpha (IL2Ra) Polyclonal Antibody
TRV-0020746-03 200 Tests

APC-Linked Anti-Interleukin 2 Receptor Alpha (IL2Ra) Polyclonal Antibody

Sign In for Pricing
View Details
CUX1 Rabbit Polyclonal Antibody (Fluoro647)
orb3113221 100 µg

CUX1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
URG4 (URGCP) (NM_001077663) Human Over-expression Lysate
LS055665 100 µg

URG4 (URGCP) (NM_001077663) Human Over-expression Lysate

Sign In for Pricing
View Details