Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA)

This Recombinant Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 2-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9BBU3

Expression Region

2-344

Origin

Lotus japonicus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAILERRESENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUX5 shRNA (h) Lentiviral Particles
sc-106798-V 200 µL

DUX5 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
FAM62B (ESYT2) Human shRNA Lentiviral Particle (Locus ID 57488)
TL304631V 500 µL Each

FAM62B (ESYT2) Human shRNA Lentiviral Particle (Locus ID 57488)

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2) Alexa Fluor® 647
sc-6278 AF647 200 µg/mL

Cytokeratin 19 (A53-B/A2) Alexa Fluor® 647

Sign In for Pricing
View Details
OTOP1 AAV siRNA Pooled Vector
35799161 1.0 µg

OTOP1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Suppressor of Fused (SUFU) Rabbit Polyclonal Antibody
TA331926 100 µL

Suppressor of Fused (SUFU) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Compound NP-024390
T128047-01 10 mg

Compound NP-024390

Sign In for Pricing
View Details