Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Photosystem Q (B) protein

This Recombinant Spinacia oleracea Photosystem Q (B) protein spans the amino acid sequence from region 2-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P69560

Expression Region

2-344

Origin

Spinacia oleracea (Spinach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d7 Mouse Gene Knockout Kit (CRISPR)
KN317258LP 1 Kit

Tbc1d7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561488 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
CD45 / LCA (CD45.1 alloantigen) Mouse Monoclonal Antibody [Clone ID: A20]
AM08062FC-N 500 µg

CD45 / LCA (CD45.1 alloantigen) Mouse Monoclonal Antibody [Clone ID: A20]

Sign In for Pricing
View Details
MFluor™ Violet 590 SE
1155-AAT 1 mg

MFluor™ Violet 590 SE

Sign In for Pricing
View Details
Recombinant Human CXCL13 protein (His Tag)
PKSH034197-01 20 µg

Recombinant Human CXCL13 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL13 protein (His Tag)
PKSH034197-02 100 µg

Recombinant Human CXCL13 protein (His Tag)

Sign In for Pricing
View Details