Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Photosystem Q (B) protein

This Recombinant Spinacia oleracea Photosystem Q (B) protein spans the amino acid sequence from region 2-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P69560

Expression Region

2-344

Origin

Spinacia oleracea (Spinach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA1 Monoclonal Antibody
E-AB-22135-01 20 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22135-02 60 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22135-03 120 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22135-04 200 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
3-(Diphenylphosphino)benzenesulfonic Acid Sodium Salt
TRC-D494920-10MG 10 mg

3-(Diphenylphosphino)benzenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
PKA R2 (PRKAR2A) Human Gene Knockout Kit (CRISPR)
KN420376 1 Kit

PKA R2 (PRKAR2A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details